cliotide T40 precursor(1037) Protein Card

General Information
Name cliotide T40 precursor
Sequence MAYPRLAVIFLLAASVMFAVKDAEA
GIPCGESCVFIPCTI
TALLGCSCKSKVCYKN
HVIAAEANIVDDHHLLCQSHEDCF
KKGSGNFCAPFLEQDVKYGWCFRAESEGFLLKDFFKMSTD
NLKMLKSITSN
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Domains cliotide T40 (982)
Nucleic acids Cter 14/ cliotide T40 mRNA
Structure
Links GenBank ALL96745
SwissProt A0A0S1RRZ9

Tools