cliotide T13 precursor(1029) Protein Card

General Information
Name cliotide T13 precursor
Sequence MTYIRLASLLVLFFFAASVEKMEA
DTTPCGESCVWIPCVS
SIVGCSCQNKVCYQN
HVIAATSKSIDEHHLLCQSHYDCIT
KGSGNFCAPFLEHDVPYGWCFHAESEGYLLKDFLKKPMKI
VI
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Domains cliotide T13 (966)
Nucleic acids Cter 23/ cliotide T13 mRNA (complete)
Structure
Links GenBank ALL96755
SwissProt A0A0S1RG98

Tools