Cter 25(1003) Protein Card

General Information
Name Cter 25
Alternative name(s) cT41
Sequence GNPIVCGETCFFQKCYTPGCSCDAVICTNN
Class Cyclotide
Technique NGS
Average Mass 3164.58
Monoisotopic Mass 3162.25
m/z M+H 3164.58
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Highly expressed in C. ternatea flower. (Gilding et al. 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter 25 precursor (partial)
Nucleic acids Cter 25 mRNA partial
Structure
Links GenBank ALL96757.1
SwissProt A0A0S1RQG0

Tools