cyclotide precursor 7c mRNA(94) Nucleic Acid Card

General Information
Name cyclotide precursor 7c mRNA
Sequence ATGAAGATGTTTGTTGCCCTTGTGCTCTTTGCAGCCTTCG
CTCTCCCCGCTGCCTTTGCAGCTCAGCAAGATGTCATCAC
TCTCCGAGCTTATGAGGAGCTTCTCAAGAATGGGGCTGCT
AATGGAATGACCAAAACTGTCATCTCAAGCCCTGTTCTTG
AAGAGGCTCTCGTCTCTTACTCCAAGAACAAGCTCGGCGG
TCTTCCTGTCTGCGGAGAGACTTGCGTCGGTGGAACATGC
AACACCCCTGGGTGCGGCTGCAGCTGGCCAGTCTGCACCA
GAAACTCTCTTGAAAGCACCAAATCTGCAAACCCTCTCCT
TGAAGAGGCACTCACCACGTTCGCCAAGAAAGGTCTTGGC
GGTCTTCCCGTCTGCGGTGAGACTTGCGTCGGCGGAACAT
GCAACACCCCTGGGTGCACTTGCAGCTGGCCTGTTTGCAC
CAGAAATGCTCTTGAGACTCAGAAACCCAACCATTTGCTC
GAAGAGGCACTCATTGCATTCGCCAAGAAAGGTAACCTCG
GTGGTCTTCCCGTATGCGGCGAAACTTGCGTTGGTGGAAC
ATGCAACACCCCTGGGTGCTCCTGCAGCTGGCCTGTTTGC
ACCAGAAACTCTCTTGCCATGTAAGACTGAGATTTAGGCA
TATGGCTGGACAATGCTCGATTTGTTGTTTGTCGTTCTCG
TTCTTGTTGTTTGTCGGAGAGGAGGCTATACATGCTGGTG
ACATATGAAATTACCTAAAATTAAAATGTAAAGCATGCCT
CCTTTCCCT
Notes
Sequence translation MKMFVALVLFAAFALPAAFAAQQDVITLRAYEELLKNGAA
NGMTKTVISSPVLEEALVSYSKNKLGGLPVCGETCVGGTC
NTPGCGCSWPVCTRNSLESTKSANPLLEEALTTFAKKGLG
GLPVCGETCVGGTCNTPGCTCSWPVCTRNALETQKPNHLL
EEALIAFAKKGNLGGLPVCGETCVGGTCNTPGCSCSWPVC
TRNSLAM
Organism Viola baoshanensis

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Proteins Encoded kalata B1
kalata S
Viba 17
cyclotide precursor 7c
Links