cyclotide precursor 6b mRNA(90) Nucleic Acid Card

General Information
Name cyclotide precursor 6b mRNA
Sequence ATGAAGATGTTTGTTGCCCTTGTGCTCTTTGCAGCCTTCG
CTCTCCCCGCTGCCTTTGCAGCTCAGCAAGATGTCATCAC
TCTCCAAGCTTATGAGGAGCTTCTCAAGAATGGGGCTGCT
AATGGAATGACCAAAACTGTCATCTCAAGCCCTGTTCTTG
AAGAGGCTCTCGTCTCTTACTCCAAGAACAAGCTCGGCGG
TCTTCCTGTCTGCGGTGAGACTTGCGTCGGCGGAACATGC
AACACCCCTGGGTGCACTTGCAGCTGGCCTGTTTGCACCA
GAAATGCTCTTGAGACTCAGAAACCCAACCATTTGCTCGA
AGAGGCACTCATTGCATTCGCCAAGAAAGGTAACCTCGGT
GGTCTTCCCGTATGCGGCGAAACTTGCGTTGGTGGAACAT
GCAACACCCCTGGGTGCTCCTGCAGCTGGCCTGTTTGCAC
CAGAAACTCTCTTGCCATGTAAGACTGAGATTTAGGCATA
TGGCTGGACAATGCTCGATTTGTTGTTTGTCGTTCTCGTT
CTTGTTGTTTGTCGGAGAGGAGGCTATACATGCTGGTGAC
ATATGAAATTACCTAAAATTAAAATGTAAAGCATGCCTCC
TTTTCCCT
Notes
Sequence translation MKMFVALVLFAAFALPAAFAAQQDVITLQAYEELLKNGAA
NGMTKTVISSPVLEEALVSYSKNKLGGLPVCGETCVGGTC
NTPGCTCSWPVCTRNALETQKPNHLLEEALIAFAKKGNLG
GLPVCGETCVGGTCNTPGCSCSWPVCTRNSLAM
Organism Viola baoshanensis

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Proteins Encoded kalata B1
kalata S
cyclotide precursor 6b
Links