Viola baoshanensis cyclotide precursor 7 mRNA(88) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 7 mRNA
Sequence ATGAAGATGTTTGTTGCCCTTGTGCTCTTTGCAGCCTTCG
CTCTCCCCGCTGCCTTTGCAGCTCAGCAAGATGTCATCAC
TCTCCAAGCTTATGAGGAGCTTCTCAAGAATGGGGCTGCT
AATGGAATGACCAAAACTGTCATCTCAAGCCCTGTTCTTG
AAGAGGCTCTCGTCTCTTACTCCAAGAACAAGCTCGGCGG
TCTTCCTGTCTGCGGAGAGACTTGCGTCGGTGGAACATGC
AACACCCCTGGGTGCGCCTGCAGCTGGCCAGTCTGCACCA
GAAACTCTCTTGAAAGCACCAAATCCGCAAACCCTCTCCT
TGAAGAGGCACTCACCACGTTCGCCAAGAAAGGTCTTGGT
GGTCTTCCTATCTGCGGTGAGACTTGCGTCGGCGGAACAT
GCAACACCCCTGGGTGCTCTTGCAGCTGGCCTGTTTGCAC
CAGAAATTCTCTCGTGTCCGAGAAGTCCAACGCTTTGCTT
GAAGAGGCACTCGTTGCATTCGCCAAGAAAGGTAACCTCG
GAGGTCTTCCCATATGCGGCGAAACTTGCGTTGGTGGAAC
CTGTAACACCCCTGGGTGCTCTTGCAGCTGGCCTGTTTGC
ACCAGAAACTCTCTTGCCATGTAAGACTGAGATTTAGGCA
TATGGCTGGACAATGCTCGATTTGTTGTTTGTCCTTCTCG
TTCTTGTTCTTGAGGAGAGGAGGCTATACATGCTCGTGAC
ATGTGAAATTACCTGAAAGTAAAATGTCAAGCATGCCGCC
TTTTCCCT
Notes
Sequence translation MKMFVALVLFAAFALPAAFAAQQDVITLQAYEELLKNGAA
NGMTKTVISSPVLEEALVSYSKNKLGGLPVCGETCVGGTC
NTPGCACSWPVCTRNSLESTKSANPLLEEALTTFAKKGLG
GLPICGETCVGGTCNTPGCSCSWPVCTRNSLVSEKSNALL
EEALVAFAKKGNLGGLPICGETCVGGTCNTPGCSCSWPVC
TRNSLAM
Organism Viola baoshanensis

References
Zhang J, Shu W, Liao B (0) Identification of cadmium responsive genes in cadmium hyperaccumulating plant Viola baoshanensis :0-0

Cross-references
Proteins Encoded cycloviolacin O12
Viola baoshanensis cyclotide precursor 7
Viba 15
Links