Viola baoshanensis cyclotide precursor 6 mRNA(87) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 6 mRNA
Sequence ATGAAGATGTTTGTTGCCCTTGTGCTCTTTGCAGCCTTCG
CTCTCCCCGCTGCCTTTGCAGTTCAGCAAGATGTCATCAC
TCTCCAAGCTTATGAGGAGCTTCTCAAGACTGGGGCTGCT
AATGGAATGACCAAAACTGTCATCTCAAGCCCTGTTCTTG
AAGAGGCTCTCGTCTCTTACTCCAAGAACAAGCTCGGCGG
TCTTCCTGTCTGCGGAGAGACTTGCGTCGGTGGAACATGC
AACACCCCTGGGTGCGGCTGCAGCTGGCCTGTTTGCACCA
GAAATGCTCTCGTGACCGAGAAGTCCAACGCTTTGCTTGA
AGAGGCACTCGTTGCATTCGCCAAGAAAGGTAACCTCGGA
GGTCTTCCCATATGCGGCGAAACTTGCGTTGGTGGAACCT
GTAACACCCCTGGGTGCTCTTGCAGCTGGCCTGTTTGCAC
CAGAAACTCTCTTGCCATGTAAGACTGAGATTTAGGCATA
TGGCTGGACAATGCTCCATTTGTTGTTTGTCGTTCTCGTT
CTTGTTCTTGAGGAGAGGAGGCTATACATGCTCGTGACAT
GTGAAATTACCTAAAAGTAAAATGTCAAGCATGCCTCCTT
TTCCCT
Notes
Sequence translation MKMFVALVLFAAFALPAAFAVQQDVITLQAYEELLKTGAA
NGMTKTVISSPVLEEALVSYSKNKLGGLPVCGETCVGGTC
NTPGCGCSWPVCTRNALVTEKSNALLEEALVAFAKKGNLG
GLPICGETCVGGTCNTPGCSCSWPVCTRNSLAM
Organism Viola baoshanensis

References
Zhang J, Shu W, Liao B (0) Identification of cadmium responsive genes in cadmium hyperaccumulating plant Viola baoshanensis :0-0

Cross-references
Proteins Encoded cycloviolacin O12
Viola baoshanensis cyclotide precursor 6
Viba 17
Links