cyclotide precursor 3b mRNA(81) Nucleic Acid Card

General Information
Name cyclotide precursor 3b mRNA
Sequence ATGGATGCCAAGAAGATGTTTCTTGCTCTTGTTCTCATTG
CAACCTTTGCAGTGATTCCATCTCTTGCAACCTTTGAGAA
AGATTTCATCACCCGAGAAGCCATTCAGGCTATCCTTAAG
AAAAGTGCCCCACTCTCAAACATCATGTTAGAGGAAGATG
TCATGAATGCTCTTATCAAGAGCAAGAGCGTCATCTCCAA
CCCAGTTATCGAAGAGGCACTCCTCAAGAACAATAATGGT
CTTAACGGCATCCCTTGCGGTGAAAGTTGTGTCTGGATTC
CATGCATCTCTTCTGCTATTGGGTGTTCTTGCAAGAACAA
AGTTTGCTACAGGAAATCTCTTGATATATAACTATCTACT
TGATGCTGCGTCTGTGTACGTATACGTACCATGTTTTTTA
TTATGTTCATCCTGTCATAATCTTCCTCCACTGTGTTTTT
AATTTGATGTGTTTTGTTTGCTGTCTTTAATTAGGAAGCT
ACACATGCTTGAAACATAGTACTAGTATACATGTCAAGCA
TGCTTCCCTCTGTGTTGGTATTTTAATAAACGCCGCTTGT
GTGTGG
Notes
Sequence translation MDAKKMFLALVLIATFAVIPSLATFEKDFITREAIQAILK
KSAPLSNIMLEEDVMNALIKSKSVISNPVIEEALLKNNNG
LNGIPCGESCVWIPCISSAIGCSCKNKVCYRKSLDI
Organism Viola baoshanensis

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Proteins Encoded cyclotide precursor 3b
Viba 9
Links