cyclotide c2 precursor(8) Nucleic Acid Card

General Information
Name cyclotide c2 precursor
Sequence ATGGAGATGAAGAATATGGTTGTTGGGCTCTTCCTCATTG
CTGCCTTTGCTCTTCCAGCCCTTGCAACAAGCTTTGAGAA
AGATTTCATCACACATGAAACCGTCCAGGCAATTCTGAAG
AAGGTCGGTCCCAGTTCAAACGGAATGCTAGATGAGCAAG
CCATTAGTGCTCTCACCGGTAAGACCATCATCTCCAACCC
AGTTCTTGAAGAGGCACTCCTCACGCACTCCAACAGTATC
AATGCTCTCGGTGGCACCCTTCCTTGCGGTGAAAGTTGTG
TTTGGATTCCTTGCATTTCCGCCGTTGTTGGGTGTTCTTG
CAAGAGCAAAGTCTGCTACAAGAACTCTCTTGCTTAAAAG
AGAGTGTTGTTGAATATGCAAGCATGATGAGCTAGTGATC
CGACTGATATGGACCATGTTCCATGTCTGTGTGTGTGTTT
TCTGCGTTTTCATTTCCCTTAAATTGTCTGTCTTGTGGAA
GCTATATGCATGCACATGTATGGGTGCAAAATACCAGTTT
AAGTGCTAGCTATCATATATTTGCTTCCACATCTCCTACG
TGTATCATCACTTAATTGAATAAAAATGGGCATCATGCAA
AAAAAAAAAAAAAAA
Notes
Sequence translation MEMKNMVVGLFLIAAFALPALATSFEKDFITHETVQAILK
KVGPSSNGMLDEQAISALTGKTIISNPVLEEALLTHSNSI
NALGGTLPCGESCVWIPCISAVVGCSCKSKVCYKNSLA
Organism Viola odorata

References
Dutton JL, Renda RF, Waine C, Clark RJ, Daly NL, Jennings CV, Anderson MA, Craik DJ (2004) Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins. J Biol Chem 279:46858-67

Cross-references
Proteins Encoded cycloviolacin O11
cyclotide c2 precursor
Links