cyclotide precursor 1c mRNA(75) Nucleic Acid Card

General Information
Name cyclotide precursor 1c mRNA
Sequence ATGGATTCCAAGATTGTCTTTGTAGCTCTTGTCCTGATTG
CCACCTTTGCCCTTCCATCCCTTGCAACCTTTGAGAAAGA
TTTCATCACCCCTGAAGCTGTGAGGGCTATCCTCAAGAAA
ACCAACGCCAATGTCATGCCATCTGAGGATGCCATTAATG
CCCTCACCGGCAAGACCGTGATCTCGAACGTTCTTCTCGA
GGAGGCACTCCTCAAGAACCTAGACAACGGTCTTAATGGC
ATCCCTTGCGGTGAAAGTTGTGTCTGGATCCCATGCCTCA
CCGCCGCGATCGGGTGTTCTTGCAGCAGCAAAGTTTGCTA
CAGAAACTCTCTTCACATGTAAGATGATGTTCCGAGATCT
ACTACCACTGACAGAGAGATGCATGCTCTCTGTCAATGAT
CGACGATCC
Notes
Sequence translation MDSKIVFVALVLIATFALPSLATFEKDFITPEAVRAILKK
TNANVMPSEDAINALTGKTVISNVLLEEALLKNLDNGLNG
IPCGESCVWIPCLTAAIGCSCSSKVCYRNSLHM
Organism Viola baoshanensis

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Proteins Encoded cyclotide precursor 1c
Viba 3
Links