Vbc4 mRNA, partial cds(70) Nucleic Acid Card

General Information
Name Vbc4 mRNA, partial cds
Sequence GGGCTGCTTTTGCCCTTCCCGCCTTTGCATCTTTCGAGAA
AGATGTGATCACTCCTTCAGTACTGGAGGCTGTCCTTAAC
AGGAAAGCTCCCCTCTCCAATATCATGATGGAGAACGACG
CGATCCTGAATGTTATCGCCAACGTCAAGACCGTCATCTC
AAATCCCGTGCTCGAAGAGGCGTTGCTTAAGACCAACCAT
GGTGTTAATGGCATCCCCTGCGGTGAAAGTTGTGTCTGGA
TTCCGTGCCTCACCTCCGCAGTTGGGTGCCCTTGCAAAAG
CAAAGTTTGCTACAGGAACTCTCTCGACAACTAATTTTTC
ACGATGATCCGGTCCAGGTGGAGCACAAGTACTGATTCTG
ATGATGATCAGTTATTGTTGTTGTTGTTTTTCTTCTTCTC
CTTCTTGTTTGAGATCTTGTGCTAGCTTGTAACATGACAT
GCATGAAAATCATGTCAAAGCTTGCTTCTTCATTTCTTTT
TTATTAAATAAGTGCGCTATCCACCGTTATTATCTACTTT
TCTTTCCATCTAAAAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation AAFALPAFASFEKDVITPSVLEAVLNRKAPLSNIMMENDA
ILNVIANVKTVISNPVLEEALLKTNHGVNGIPCGESCVWI
PCLTSAVGCPCKSKVCYRNSLDN
Organism Viola biflora

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Proteins Encoded vibi K
Vbc4 precursor protein (partial)
Links