Mra4 mRNA(65) Nucleic Acid Card

General Information
Name Mra4 mRNA
Sequence ATGGAGAGCAACAAGATGGTTGTAGGGGTTTTGCTCATTG
CTGCCTTTGCTCTTCCAGCCCTTGCACTCTTTGAAAGGGA
TGTGATCACTCATGAAACCATTGAGGCTGTTCTTAAGAAA
TCAACCCCCAACTCAAACACCATGCTCCAAGAAGATGCCA
TCAATGCTCTCACCGGCAAGACCCTCATCTCTCAAACCAT
CCTCGAAGAGACACTCCTTAAGAATGGTGTTGTTGGTGGT
AGCATTCCCTGCGGTGAAAGCTGTGTCTATATTCCATGCA
TCTCCAGTCTGCTTGGGTGTTCTTGCAAAAGTAAAGTTTG
CTACAAGAACTCTCTTGCCCTTCCAACCTTGGAAAAAGAT
GTGATCACCCCTGAAGCTCTTGAGGCTGTTCTTAAAAGCA
ATGGTGGTGCCATTGTTAACACCAAAACCATTATCTCAAA
CGCCATCTTCGAGGAGACACTCCTTAACAATGCCAACCAT
GTTCTTGGTGGTATTCCTTGCGCTGAAAGCTGTGTCTATA
TTCCATGCCTCACTAGCGCTATTGGGTGCTCTTGCAAGAG
CAAAGTTTGCTACAGAAACTCTCTTGCTCTTAACTAAGAC
CCATCAATCTTGACAATAGCGTGGATCAAATAATTTGTGT
TACATCAGTGTGCTATAAGGTTGTTGCCTTGGCTCGCGCT
AGGAAGCTATGTATGCTTATAACATGCTACGAAATCATGT
CAAGCATGCTTCCAAGATATCTGTCTTTTTAATTTAATAA
AATTATGTTCCACGCCATGGTATGCACT
Notes
Sequence translation MESNKMVVGVLLIAAFALPALALFERDVITHETIEAVLKK
STPNSNTMLQEDAINALTGKTLISQTILEETLLKNGVVGG
SIPCGESCVYIPCISSLLGCSCKSKVCYKNSLALPTLEKD
VITPEALEAVLKSNGGAIVNTKTIISNAIFEETLLNNANH
VLGGIPCAESCVYIPCLTSAIGCSCKSKVCYRNSLALN
Organism Melicytus ramiflorus

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Proteins Encoded Mra4 precursor protein
Mra4
Mra5
Links