Mra30 mRNA, partial cds(64) Nucleic Acid Card

General Information
Name Mra30 mRNA, partial cds
Sequence CTTGCACTCTTTGAAAGGGATGTGATCACTCGTGAAACCG
TTGAGGCTGTTCTTAAGAAAACTAACCCCAACTCAAACAC
CATGCTCCAAGAGGATGCCATCAATGCTCTCACCGGCAAG
ACCCTCATCTCTCAAACCATCCTCGAAGAGGCACTCCTTA
AGAATGGTGTTGTTGGTGGTAGCATTCCCTGCGGTGAAGG
TTGTGTCTTTATTCCATGCATCTCCAGTATTGTTGGGTGT
TCTTGCAAAAGCAAAGTTTGCTACAAGAACTCTCTTGCCC
TTCCAACCTTGGAAAAAGATGTGATCACCCCTGCAGCTCT
TGAGGCTGTTCTTAAAAGCAACGGTGGTGCCATTGTTAAC
ACCAAAACCATTATCTCAAACGCCATCTTCGAGGAGACAC
TCCTTAACAATGCCAACCATGTTGTTGGTGGTATTCCCTG
CGGTGAAAGCTGTGTTTTTATTCCATGCCTCACTAGCGCT
ATTGGGTGCTCTTGCAAGAGCAAAGTTTGCTACAGGAACT
CTCTTGCTGCTAACTAAGACCCATCAATCTTGGCAATAGC
TAGCGTGGAGCATAATCCGTGTTTGTGCTATGTTGTACTG
TTGACTTTTGTGGTAGGAATCTATATATGCTTCTAACATG
CTGCCAAATCATGTGAAGCA
Notes
Sequence translation LALFERDVITRETVEAVLKKTNPNSNTMLQEDAINALTGK
TLISQTILEEALLKNGVVGGSIPCGEGCVFIPCISSIVGC
SCKSKVCYKNSLALPTLEKDVITPAALEAVLKSNGGAIVN
TKTIISNAIFEETLLNNANHVVGGIPCGESCVFIPCLTSA
IGCSCKSKVCYRNSLAAN
Organism Melicytus ramiflorus

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Proteins Encoded Mra30
Mra30 precursor protein (partial)
Mra30
Links