Mra24 mRNA, partial cds(58) Nucleic Acid Card

General Information
Name Mra24 mRNA, partial cds
Sequence ATTAGCAGCCTATGAAATCAAAGATGTGATCTCTCGCAAT
GCTATTGAGGGTGTTCTTAAGAAGAGGGTAGGCTTCCTCT
CAGAGGAAGCTATTAATGGGCTTGCTCTGGGCAAGACAAT
TATCTCCAACCCAGTTCTAGAAGAGGCACTTGTTATGTAT
GCCAAGAGTGAAGGTCTTGGTGGTCACCCTACTTGTGGAG
AAACTTGCTTGCTTGGTACATGCTACACCCCAGGGTGTAC
TTGCAAACGGCCTGTGTGTTACAAAAATTCTCTTGATGCG
TAAGAGCCTTCAATATTGTTGAGAGTAATATGACTGGACT
AAGTGTTGTTGTCGCCGTCTTAATAAAGGAAGCTATACAT
GCTTGTAAACATATATACACCACAAAATATGGCAAGCATG
CTTCCTCAGTTGTTTTCTTGTTGTTTCGTCACTAAATAAA
AGTCCAGCATCCATCGTTTAATGTT
Notes
Sequence translation LAAYEIKDVISRNAIEGVLKKRVGFLSEEAINGLALGKTI
ISNPVLEEALVMYAKSEGLGGHPTCGETCLLGTCYTPGCT
CKRPVCYKNSLDA
Organism Melicytus ramiflorus

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Proteins Encoded Mra24 precursor protein (partial)
Mra24
Links