Mra14 mRNA, partial cds(52) Nucleic Acid Card

General Information
Name Mra14 mRNA, partial cds
Sequence CCTTGCAATCTTTGAAAGGGATGTGATCACTCCTGAAACC
ATTGAGGCTGTTCTTAAGAAAACCAACCCCAACTCAAACA
TCATGCTCCAAGAAGATGCCATCAATGCTCTCACCGGCAA
AACCCTCATCTCCAAAACCATCCTCGAAGAGGCATTCCTT
AAGAATGGTGTTGTCGGTGGTAGCATTCCCTGCGGTGAAA
GCTGTGTCTTTATTCCATGCATCTCCAGTGTTGTTGGGTG
TTCTTGCAAAAACAAAGTTTGCTACAAGAACTCTCTTGCT
CTTCCAACCTTGGAAAAAGATGTGATCACCCCTGAAGCTC
TTGAGGCTGTTCTTAAAAGCAATGGTGGTGCCATTGTTAA
CATCAAAACTATTGTCTCAAACACCATCTTCGAGGAGGCA
CTCCCTAACAATGCCAACCATGGTCTTGGTGGTACCATTC
CCTGCGGTGAAAGCTGTGTCTTTATTCCATGCCTCACTAG
CGCTATTGGGTGCTCTTGCAAGAGCAAAGTTTGCTACAAG
AACTCCCTTGCCCTTAACTAAGACCCGTCAATCTTGACAA
TAGCGTGGAGCATATAATTTGTGTTACATAGTTGTGCTGT
AAGGTTGTTGTCTTGGCTTTTGAGCTAGGAAGCTATGTAT
GCTTGTAACATGCTACGAAATCATGTCAAGCA
Notes
Sequence translation LAIFERDVITPETIEAVLKKTNPNSNIMLQEDAINALTGK
TLISKTILEEAFLKNGVVGGSIPCGESCVFIPCISSVVGC
SCKNKVCYKNSLALPTLEKDVITPEALEAVLKSNGGAIVN
IKTIVSNTIFEEALPNNANHGLGGTIPCGESCVFIPCLTS
AIGCSCKSKVCYKNSLALN
Organism Melicytus ramiflorus

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Proteins Encoded Mra14a
Mra14b
Mra14 precursor protein (partial)
Links