cyclotide k1 precursor(5) Nucleic Acid Card

General Information
Name cyclotide k1 precursor
Sequence ATGAAGATGTTTATTGTGCTTGTGCTCTCTGCAGCTTTTG
CTCTTCCTGCTGCCTTTGCAACTGAGCAAGATGTCATCAC
TCTCCAAGCTTACGAGGAGCTTCTCAAGAATGGGGCTGCT
AATGGAATGACCAAAACTGTCATCTCAAGCCCGGTTCTTG
AAGAGGCTCTCGTCTCTTACTCCAAGAACAAGCTTGGCGG
TCTTCCTGTCTGCGGAGAGACTTGCGTTGGTGGAACATGC
AACACCCCTGGGTGCTCCTGCAGCTGGCCAGTCTGCACCA
GAAACTCTCTTGAAAGCACCAAATCAGCAAACCCTCTCCT
TGAAGAGGCACTCACCGCGTTCGCCAAGAAAGGTCTTGGT
GGTCTTCCCGTCTGCGGTGAGACTTGCGTCGGCGGAACAT
GCAACACCCCTGGGTGTACTTGCAGCTGGCCTGTTTGCAC
CAGAAATGCTCTTGAGACCCAGAAACCCAACCATTTGCTC
GAAGAGGCACTCGTTGCATTCGCCAAGAAAGGTAACCTCG
GAGGTCTTCCCGTATGCGGCGAAACTTGCGTTGGTGGAAC
CTGTAACACCCCTGGGTGCTCTTGCAGCTGGCCTGTTTGC
ACCAGAAACGCTCTTGCCATGTAAGACCGAGATCTAGGCA
TATGACGGGACCATATTGTTCCATTTGTTGTTTCTCGTTC
TTGTTCTTGTTCTTTGCCTTTATGTTANAGGAGAGGAGGC
TATACATGCTCGTGACATATGGATTTACCAAAAAGTAATA
CGTCAAGCATGCCTCCTCTTCCCCTCCNTTCTGTTTGAAT
TAATAAAAGTCCAGTTATTATGAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MKMFIVLVLSAAFALPAAFATEQDVITLQAYEELLKNGAA
NGMTKTVISSPVLEEALVSYSKNKLGGLPVCGETCVGGTC
NTPGCSCSWPVCTRNSLESTKSANPLLEEALTAFAKKGLG
GLPVCGETCVGGTCNTPGCTCSWPVCTRNALETQKPNHLL
EEALVAFAKKGNLGGLPVCGETCVGGTCNTPGCSCSWPVC
TRNALAM
Organism Viola odorata

References
Dutton JL, Renda RF, Waine C, Clark RJ, Daly NL, Jennings CV, Anderson MA, Craik DJ (2004) Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins. J Biol Chem 279:46858-67

Cross-references
Proteins Encoded kalata B1
kalata S
cyclotide k1 precursor
Vontr Protein
Links