Bacillus subtilis subtilosin gene cluster, complete sequence(49) Nucleic Acid Card

General Information
Name Bacillus subtilis subtilosin gene cluster, complete sequence
Sequence ATGAAAAAAGCTGTCATTGTGGAAAACAAAGGTTGTGCAA
CATGCTCGATCGGAGCCGCTTGTCTAGTGGACGGTCCTAT
CCCTGATTTTGAAATTGCCGGTGCTACAGGTCTATTCGGT
CTATGGGGATAA
Notes
Sequence translation MKKAVIVENKGCATCSIGAACLVDGPIPDFEIAGATGLFG
LWG
Organism Bacillus subtilis

References
Stein T, Dusterhus S, Stroh A, Entian KD (2004) Subtilosin production by two Bacillus subtilis subspecies and variance of the sbo-alb cluster. Appl Environ Microbiol 70:2349-53

Cross-references
Proteins Encoded subtilosin A precursor
subtilosin A
Links