Streptococcus uberis PurH-like protein(48) Nucleic Acid Card

General Information
Name Streptococcus uberis PurH-like protein
Sequence ATGGACATTTTATTAGAACTCGCAGGATATACTGGGATAG
CCTCAGGTACTGCAAAAAAAGTTGTTGATGCCATTGATAA
AGGAGCTGCAGCCTTTGTTATTATTTCAATTATCTCAACA
GTAATTAGTGCGGGAGCATTGGGAGCAGTTTCAGCCTCAG
CTGATTTTATTATTTTAACTGTAAAAAATTACATTAGTAG
AAATTTAAAAGCACAAGCTGTCATTTGGTAA
Notes
Sequence translation MDILLELAGYTGIASGTAKKVVDAIDKGAAAFVIISIIST
VISA GALGAVSASADFIILTVKN
YISRNLKAQAVIW
Organism Streptococcus uberis

References
Wirawan RE, Swanson KM, Kleffmann T, Jack RW, Tagg JR (2007) Uberolysin: a novel cyclic bacteriocin produced by Streptococcus uberis. Microbiology 153:1619-30

Cross-references
Proteins Encoded Uberolysin A
Uberolysin precursor UblA
Links