butyrivibriocin AR10 operon, complete sequence(47) Nucleic Acid Card

General Information
Name butyrivibriocin AR10 operon, complete sequence
Sequence ATGAGTAAAAAACAAATTATGAGTAACTGTATATCAATTG
CATTATTAATAGCACTAATTCCTAATATCTATTTTATTGC
AGATAAAATGGGAATTCAGTTAGCACCTGCTTGGTATCAA
GATATTGTGAATTGGGTATCTGCTGGTGGAACACTTACTA
CTGGTTTTGCGATTATTGTAGGAGTTACAGTACCGGCATG
GATAGCAGAAGCAGCTGCAGCTTTTGGTATAGCTTCAGCA
TGA
Notes
Sequence translation MSKKQIMSNCISIALLIALIPNIYFIADKMGIQLAPAWYQ
DIVNWVSAGGTLTTGFAIIVGVTVPAWIAEAAAAFGIASA
Organism Butyrivibrio fibrisolvens

References
Kalmokoff ML, Cyr TD, Hefford MA, Whitford MF, Teather RM (2003) Butyrivibriocin AR10, a new cyclic bacteriocin produced by the ruminal anaerobe Butyrivibrio fibrisolvens AR10: characterization of the gene and peptide. Can J Microbiol 49:763-73

Cross-references
Proteins Encoded butyrivibriocin AR10 precursor
Links