Viola baoshanensis cyclotide precursor 1 mRNA(46) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 1 mRNA
Sequence GGCACCAATTAGCAATCAACCACACATCTTATTAGCAAAT
CTAAGTCAATCAGTAGCCCATATGGATTCCAAGATTGTCT
TTGTAGCCCTCGTCCTGATTGCCACCTTTGCCCTTCCAAC
CCTTGCAACCTTTGAGAAAGATTTCATCACCACTGAAGCT
GTYAGGGCTATCCTCAAGAAAACCAACGCCAATGTCATGC
CATCTGAGGATGTCATTAATGCCCTCACCGGCAAGACCGT
CATCTCGAACGTTGTTCTGGAGGAGACACTCGTCATGAAA
CTCGACAACGGTCTTACTGGCATCCCTTGCGGTGAAAGTT
GTGTCTACCTCCCATGCTTCACCGCCCCGCTCGGGTGTTC
ATGCAGTAGCAAAGTTTGCTACAGAAACTCTCTTCACATG
TAAGATGATGTTCCGAGATCTACTACCACTGACAGAGAGA
TGCATGCTCTCTGCCAATGATCGACGATCCAATCATCAAT
CTCTACTTCTATCCAGTCTGTTGTTTTTACTTAAGAAGCT
ATAAAATGCTTAGAACATATATATGGATACATGTATGTGT
CAAGCATGCTTCCAAGTCATTTCTCTTTCAATTTCAATAA
AATGTTTGCTGCTCTTGTGTCAAAAAAAAAAAAAAAAAAA
AAA
Notes
Sequence translation MDSKIVFVALVLIATFALPTLATFEKDFITTEAVRAILKK
TNANVMPSEDVINALTGKTVISNVVLEETLVMKLDNGLTG
IPCGESCVYLPCFTAPLGCSCSSKVCYRNSLHM
Organism Viola baoshanensis

References

Cross-references
Proteins Encoded Viola baoshanensis cyclotide precursor 1
Viba 2
Links