Viola baoshanensis cyclotide precursor 2 mRNA(45) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 2 mRNA
Sequence GGCACCCATTAGCAATCACACACAAACACAAGTTATTAGC
AAAACCAAGTTATAACATCCTTCTTAATTAGCCAATATGG
ATTCCAAGATTGTGTTTGTTGCCCTTGTCCTCATTGCAAC
CTTTGCCCTTCCATCCCTTGCAACCTTTGAGAAAGATTTC
ATCACCACTGAAGCTGTTAGGTCTATCCTCCAGAAAACCA
ACTCCAATGCCATGCCCTCAGAGGATGCCATTAACGCCCT
CACCGGCAAGACCCTCCTCTCGAGCGTTGTTCTCGAGGAG
GCACTCCTCAAGAACCTCGACAACGGTCGTAATGGCATCC
CTTGCGGTGAAAGTTGTGTCTGGATTCCATGCCTCACTGC
TACGATCGGGTGTTCTTGCAAGAGCAAAGTTTGCTACAGA
AACTCTCTTGACATGTAAGATGTTCCAAGATCTACCACTT
GCAGAGAGATGCATGCTCTCTGTCATTGTTCGATGCTAAT
CATCAATCTCATCATCTATCCAGTTTGTTGTTTTCAATTA
GGAAGCTATAAATGCTTAAGACATATATAGCTAGTAGCGC
TAGTTGCAAACTTATATGTATGTTAAGCATGCTTCCAAGT
CATTTCTCTTTCAAATATAATAAAAACTTTGCTGCTTGTA
TCGAGTATCTAAAAAAAAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MDSKIVFVALVLIATFALPSLATFEKDFITTEAVRSILQK
TNSNAMPSEDAINALTGKTLLSSVVLEEALLKNLDNGRNG
IPCGESCVWIPCLTATIGCSCKSKVCYRNSLDM
Organism Viola baoshanensis

References

Cross-references
Proteins Encoded Viola baoshanensis cyclotide precursor 2
Viba 5
Links