Viola baoshanensis cyclotide precursor 3 mRNA(44) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 3 mRNA
Sequence GGCAAGCAACACTTAGCAATCAATCAAACACACACAAAGA
CCTTAGAAAAAACATACTCCTAAGTAGCCAACATGGATGC
CAAGAAGATGTTTCTTGCTCTTGTTCTCATTGCAACCTTT
GCAGTGATTCCATCTTTTGCAACCTTTGAGAAAGATTTCA
TCAGCCCAGAAGCCGTTCAGGCTATCCTTAAGAAACGTGC
CCCACTCTCAAACATCATGTTAGAGGAAGATGCCATGAGT
GCTCTTATCAAGAGCAAGACCGTCATCTCCAACCCAGTTA
TCGAAGAGGCACTCCTCAAGAACAGTAACAGTCTTCACGG
CATCCCTTGTGCTGAAAGTTGTGTATATCTTCCATGCGTG
ACTATTGTTATTGGGTGTTCTTGCAAGGACAAAGTTTGCT
ACAACTCTCTTGATATATAACTAGCTACTTGATGCTGCGT
CTGCGTGCGTACGTACGTGCCATGCGTTTTATTATGTCCA
TCCCGTCATAATCGTCCTCCACTTTGTGTTTTTAATTTGA
TGTGTTTTGTTTGTTGTCTTTAATTAGGAAGCTACAGATG
CTTGAAACATAGTAGTGGTCTACATGTCAAGCATGTTTCC
CTTTGTGTTGGTATTTCAATAAACGCCGCTTGTGTGTGGT
TGTCGGCTTTAAATTTAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
Notes
Sequence translation MDAKKMFLALVLIATFAVIPSFATFEKDFISPEAVQAILK
KRAPLSNIMLEEDAMSALIKSKTVISNPVIEEALLKNSNS
LHGIPCAESCVYLPCVTIVIGCSCKDKVCYNSLDI
Organism Viola baoshanensis

References

Cross-references
Proteins Encoded Viola baoshanensis cyclotide precursor 3
Viba 10
Links