Viola baoshanensis cyclotide precursor 4 mRNA(43) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 4 mRNA
Sequence ATCCACTCATCACTTAATAAGAGCTAAAGCTAAAACCATA
ACAAATCAGTCAATCAATATTATTATGGAGAGCAACAAGA
AGATGCAGCTTGTTGGGTTTGTGCTCCTGGCCGCCTTTGC
GCTACCAGCACTTGCATCATCTTTCGAGAAAGATGTGATC
TCTCCCCGTGCCATCCAGGCTGTTCTTGAGAAGAGGGGAT
TAAGCAAGCTGGAGGATGATCCTGTCTTGAGCGCTCTTGC
TCGCACCAAAACCATCATCTCTAACCCTGTCATCGAAGAG
GCTTTGCTTAATGGTGCCAACCTGAAAGCAGGTAATGGAA
TCCCCTGCGCCGAGAGCTGCGTGTGGATTCCATGCACAGT
CACAGCCTTACTTGGGTGCTCATGCAAGGACAAAGTTTGC
TACAACTCTCTCCAAACCAAGTACTGAACGCTCGTGTCAT
GCTCCCTCTTTCTACTGTATTGAATTGATGAGAGCACCTG
AGTTGTCGTCATCGTCGTAGTCGTACGTTGTTGTTGTTGT
TGTTGTTTCGTTGTTGTCAATAATCAGGGAAGCTACAAGT
GCTTGTAGCATGCCATATGAGATCAATGCCAAGCATGCTT
CCCTTCCCCACCACTTGTTTCTATCATCCTCTCATTTTCA
AATATTTGTTTCATTTACCTACTAATTAATTGGGTAAAAT
ATGATTGTTTTCCGTCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
Notes
Sequence translation MESNKKMQLVGFVLLAAFALPALASSFEKDVISPRAIQAV
LEKRGLSKLEDDPVLSALARTKTIISNPVIEEALLNGANL
KAGNGIPCAESCVWIPCTVTALLGCSCKDKVCYNSLQTKY
Organism Viola baoshanensis

References

Cross-references
Proteins Encoded Viola baoshanensis cyclotide precursor 4
Viba 12
Links