Viola baoshanensis cyclotide precursor 5 mRNA(42) Nucleic Acid Card

General Information
Name Viola baoshanensis cyclotide precursor 5 mRNA
Sequence ACACACACTACTAAATCAAAGTTCAAAAGATGAAGATGTT
TGTTGCCCTTGTGCTCTTTGCAGCTTTTGCTCTCCCCGCA
GCCTTTGCAGCTCAGCAAGATGCCATCGCTCTCCAAGCTT
ATGAGGAGCTTCTCAAGAATGGGGCTGCTAATGGAATGAC
CGAAACTGTCATCTCAAACCCTGTTCTTGAAGAGGCACTC
ACCGCGTTCTCCAAGAAAGGTCTTGAGGGTCGTCTATGCG
GTGAGAGGTGCGTCATCGAAAGAACCAGAGCATGGTGCAG
GACCGTTGGATGCATTTGCTCTTTACATACCTTAGAGTGC
GTCAGAAACTCTCTTCCCATGTAAGACTGAGACATAGGAA
TATGACTGGACCATGTTGTTCCATTTGTTGTTTCTCGTTC
TCGTTGTTGTTCTTGTTCTTTGCCTTTATGCTAGAGGAGA
GGAGGCTATACATGCTCGTGACATATGAATTTACAAAAAA
AATAAAAGTCATCTCAAGCATGCCTCCTTTTCCCTTCCTT
TCTATTTGAATAAATAAAAGTCCAGTTAATTATTTGTGCT
AAAAAAAAAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MKMFVALVLFAAFALPAAFAAQQDAIALQAYEELLKNGAA
NGMTETVISNPVLEEALTAFSKKGLEGRLCGERCVIERTR
AWCRTVGCICSLHTLECVRNSLPM
Organism Viola baoshanensis

References

Cross-references
Proteins Encoded Viola baoshanensis cyclotide precursor 5
Viba 14
Links