kalata B1 precursor [OaK1](4) Nucleic Acid Card

General Information
Name kalata B1 precursor [OaK1]
Sequence GGCACCAGCACTTTCTTAAAATTTACTGCTTTTTCTTATT
TCTTGTTCTGTGCTTGCTTCTTCCATGGCTAAGTTCACCG
TCTGTCTCCTCCTGTGCTTGCTTCTTGCAGCATTTGTTGG
GGCGTTTGGATCTGAGCTTTCTGACTCCCACAAGACCACC
TTGGTCAATGAAATCGCTGAGAAGATGCTACAAAGAAAGA
TATTGGATGGAGTGGAAGCTACTTTGGTCACTGATGTCGC
CGAGAAGATGTTCCTAAGAAAGATGAAGGCTGAAGCGAAA
ACTTCTGAAACCGCCGATCAGGTGTTCCTGAAACAGTTGC
AGCTCAAAGGACTTCCAGTATGCGGTGAGACTTGTGTTGG
GGGAACTTGCAACACTCCAGGCTGCACTTGCTCCTGGCCT
GTTTGCACACGCAATGGCCTTCCTAGTTTGGCCGCATAAT
TTGCTTGATCAAACTGCAAAAATGAATGAGAAGGCCGACA
CCAATAAAGCTATCAATGTAGTTGGTCCCTGTACTTAATT
TGGTTGGCTCCAAACCATGTGTGCTGCTCTTGTTTTTGTT
TTTTCTTTTTTCTTCTCTCTTTCGGGCACTCTTCAGGACA
TGAAGTGATGATCAGTACTCTTTGCTATCATGTTTTCTGT
GCACACCTTCTATTGTAGGTGTTGTTGTGATGTTGATGCC
CAATTGGAATAAACTGTTGTCGTTGTTAAAAAAAAAAAAA
AAAA
Notes
Sequence translation MAKFTVCLLLCLLLAAFVGAFGSELSDSHKTTLVNEIAEK
MLQRKILDGVEATLVTDVAEKMFLRKMKAEAKTSETADQV
FLKQLQLKGLPVCGETCVGGTCNTPGCTCSWPVCTRNGLP
SLAA
Organism Oldenlandia affinis

References
Jennings C, West J, Waine C, Craik D, Anderson M (2001) Biosynthesis and insecticidal properties of plant cyclotides: the cyclic knotted proteins from Oldenlandia affinis. Proc Natl Acad Sci U S A 98:10614-9

Cross-references
Proteins Encoded kalata B1
kalata B1 precursor
Oantr protein
Links