Hyca A (partial)(37) Nucleic Acid Card

General Information
Name Hyca A (partial)
Sequence TGTGGGGAGACGTGCGTGGTTGATACGCGCTGTTACACCA
AAAAATGTAGCTGTGCCTGGCCCGTATGCATGAGGAATTC
TCTTGCTGGATAA
Notes
Sequence translation CGETCVVDTRCYTKKCSCAWPVCMRNSLAG
Organism Hybanthus calycinus

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Proteins Encoded Hyca A (partial)
Hyca A precursor (partial)
Links