PLP-53 precursor(338) Nucleic Acid Card

General Information
Name PLP-53 precursor
Sequence ATAATGGCGAAAGTTGTAGTTGTTGCATTAGCCATGGCAG
CGATGATCTTAGCGTTTGATGAGGTTGCAGGGTATACAAC
AACCACCACCACCACCACAGAGGACAATGGCTCGCGTATT
TGGGTGCCTGGCTTAGGGCCAGTTTATGAAGAGGACGGCC
TGGACAACCGCAGAGGTAGCTGCCAGATTCAGATCCAAGA
GCTGAGCCACTGCCAGATGCACCTGACCAGCCCCTCTTTC
GACTACAGGCTGAGGATGGCCGTGGAGAACCCAAAACAAC
AACAGCACCTTGACCTGTGCTGCAACCAGCTCCGGCAAGT
GGGGGAAGAGTGTCAGTGCGAGGCCATCAAACAGCTGGTG
GGACGACAACTTCAGAAGAAGCAAGGGTATGGAAAGCAAC
AGGTTTTGGAACAGATAGCCAAGAAGGCTCAGATGCTCTC
CAACCAATGCAACCTGCAATGCTCAATCTGAACCCAACCG
TGCACTCGTACTACTACTGCTTGTGTTTCCGAATAATGCA
TGCATGCATGTAATATATACTAAATA
Notes
Sequence translation MAKVVVVALAMAAMILAFDEVAGYTTTTTTTTEDNGSRIW
VPGLGPVYEEDGLDNRRGSCQIQIQELSHCQMHLTSPSFD
YRLRMAVENPKQQQHLDLCCNQLRQVGEECQCEAIKQLVG
RQLQKKQGYGKQQVLEQIAKKAQMLSNQCNLQCSI
Organism Ratibida columnifera

References
Fisher, M.F., Payne, C.D., Rosengren, K.J. and Mylne, J.S. (2019) An orbitide from Ratibida columnifera seed containing 16 amino acid residues Journal of Natural Products 82:2152-2158

Cross-references
Proteins Encoded PLP-53 precursor
Links GenBank MK310276