Proannomuricatin HI(335) Nucleic Acid Card

General Information
Name Proannomuricatin HI
Sequence AGCTAAGCAATCGCAGTTGGCAGATAAGACAGAGAGATGG
AGATGGAGGAGACGCTGGTGCCTGGTTACTCACCATCGGT
TTCTCACCACCACGGCTCATCAGGCCTCTTCCTCCACGCG
CACCATCTACCCAACAGCGAAGGATTTATGCATTCTCCGG
TGCCGTTGGTCAGCTGCCGTGGGCAGCTCGTTTCCGTCGA
TCCCTGTCAAGTCTGATGAGGATGCGATCGATGGAAGTCC
TTGTCTAACATTGTCTTCTGCTACTACAGCAGTAGTATTA
CCATATTTACTAAGATAAGGACGTCTATATATCGCTACAA
AAAGTATATAGAGATGGCCGTCCTGTCTTCTCTTCC
Notes
Sequence translation MEMEETLVPGYSPSVSHHHGSSGLFLHAHHLPNSEGFMHS
PVPLVSCRGQLVSVDPCQV
Organism Annona muricata (guanabana)

References
Fisher, M.F., Zhang, J., Berkowitz, O., Whelan, J. and Mylne, J.S. (2020) Cyclic Peptides in Seed of Annona muricata Are Ribosomally Synthesized Journal of Natural Products. 83:1167-1173

Cross-references
Proteins Encoded Proannomuricatin HI
Links GenBank MK836463