proannomuricatin EF(333) Nucleic Acid Card

General Information
Name proannomuricatin EF
Sequence AACAGCAGTCGCAGCTCGCAGGTACAGAGGGAGATGGACT
CCCCTAAGAGCGAAGGACTTGTAACTGTGCCGTCGGTTGC
CTACCATCACACAGCATCAGGGCTCTTCCTCCACACCCAC
CAGCTGCCCAACAGCGAAGGTCTTAGTGCTGTGACGCCGG
GCCATCATTCCTCACCGGACCTCCTCATTTCCGTCCATCC
CTGTCAAGCCTGATGAGGCAAGCGTGCGTGCGTGCCTGCA
TGCGGCACGTATTACTACATACTATAAGGGTAATACGTAC
TAGAGTACTAGTACCACTAAGATAAGAACGTCGATGACCA
TTTTCTCTCCGTAAGTACGTATCATGTCTTATGTAGTGTG
TTCTTCGTTTCAAATATAATAAATAAGAGCGAGGTGGTCA
TCTGATTTTCTGCTGTGTTTCTTTGCTGCT
Notes
Sequence translation MDSPKSEGLVTVPSVAYHHTASGLFLHTHQLPNSEGLSAV
TPGHHSSPDLLISVHPCQA
Organism

References
Fisher, M.F., Zhang, J., Berkowitz, O., Whelan, J. and Mylne, J.S. (2020) Cyclic Peptides in Seed of Annona muricata Are Ribosomally Synthesized Journal of Natural Products. 83:1167-1173

Cross-references
Proteins Encoded Proannomuricatin EF
Links GenBank MK836461