ProannomuricatinAD(332) Nucleic Acid Card

General Information
Name ProannomuricatinAD
Sequence TGGGAGACAGGTAGATACAGAGAGAGAGAGAGATGCAGTG
TGATAAGATGGAAGGATTTGTATCTGCTCCGGCGGTTTCG
CACCACCACGGAGCATCAGGGCTTTTCCTTCACGCGCAGC
AGCTGCCCAACAGCGAAGGACATTCTATTTTTCCGCCGAT
TCCGTCGTTGGTCAGCGGCCGCAGCCACCTCGTTTCCGTC
GATCCCTGTCAAGTCTGATAGGGGATATGCCTTATATGTA
AGCAATGGAATTAAAGTCCTTGCCTAATGTCTACTACTAC
AGTAGTGCTACATATCCATTGAGATGACCGACCATCTTCT
CTTCCTACTTCGTGCTTGTCATGTCTTAGCCTTGTCTTAT
GCTGTGCTGTCTCGAATAAACGAAGGTCGGTGGTGGTCAT
GGTCATCTCATTCTCTCTGTTTGTCAGTCTGTCTTGTCTC
TCTCTCTTTCTACCGAT
Notes
Sequence translation MQCDKMEGFVSAPAVSHHHGASGLFLHAQQLPNSEGHSIF
PPIPSLVSGRSHLVSVDPCQV
Organism Annona muricata (guanabana)

References
Fisher, M.F., Zhang, J., Berkowitz, O., Whelan, J. and Mylne, J.S. (2020) Cyclic Peptides in Seed of Annona muricata Are Ribosomally Synthesized Journal of Natural Products. 83:1167-1173

Cross-references
Proteins Encoded Proannomuricatin AD
Links GenBank MK83646