Momordica dioica two inhibitor peptide topologies precursor 1 gene, complete cds(330) Nucleic Acid Card

General Information
Name Momordica dioica two inhibitor peptide topologies precursor 1 gene, complete cds
Sequence ATGGAGAGCAAGAAGCTTCTTCCGGTGGTGCTGGTGGCGA
TGGTGCTGGTTGCTACCTCGACATGCTTCAACGACGGCTA
CACAACAGACCTCATCTCCGACGGTCGAGCTCAAATGGAC
ATTAACGGTGGTGCCTGTCCCAAAATCTTGCAGAGATGCA
GACGCGACTCCGATTGCCCCGGTGCATGTATTTGCCGGGG
GAACGGGTATTGCGGTAGCGGTAGCGACGCAATAGACCTC
ATCTCCAACGGTCGAGCTCAAATCTACATTAACGGTGGTG
CCTGTCCCAAAATCTTGCAGAAATGCAGACGCGACTCCGA
TTGCCCTGGTGCATGTGTTTGCCAAGGGAACGGGTATTGC
GGTAGCGGTAGCGACGCGTTAGACCTCATCTCCGACGGTG
GAGCCCAAATCGACATTAACGGTGGTGCCTGTCCCAAAAT
CTTGCAGAAATGCAGACGCGACTCCGATTGCCCCGGCGCA
TGTGTTTGCCAGGGGAATGGGTATTGCGGTAGCGGTAGCG
ACGCGTTAGACCTCATGTCCGACGGTCGAGCTCAAATTGA
CATTAACGGTGGTGCCTGTCCCAGAATCTTGCAGAAATGC
AGGCGCAACTCCGATTGCCCCAGTGCATGTGTTTGCCAGG
GGAATGGGTATTGCGGTAGCGGTAGTGATGCGTTAGACCT
CATGTATGACGGTCGAGCCCAAATCGACATTAACGGTGGT
GCCTGTCCGAGAATCTTGAAGAAATGCAGACGCGACTCCG
ATTGCCCCGGTGCATGTGTTTGCCGGGGGAATGGGTATTG
CGGTAGCGGTAGTGATGCGTTAGACCTCATGTCCGACGGT
CGAGCCCAAATTGACATTAACGGTGGTGCCTGTCCCAGAA
TCTTGAAGAAATGCAGACGCGACTCCGATTGCCCCAGTGC
ATGTATTTGCCAGGGGAACGGGTATTGCGGTAGCGGTAGC
GACGCGTTAGACCTCATGTCCGACGGTGGAGCTCAAACTG
GCGAAGACATTAATGGCGGTGGAGTGTATGACGAGAAACA
AAGAGTCTGTCCTAGAATCTTAAAGAAATGCAGGCGCGAC
TCCGATTGCCCCGGTGAATGTATTTGCCAAGGGAACGGGT
ATTGTGGTTAA
Notes
Sequence translation MESKKLLPVVLVAMVLVATSTCFNDGYTTDLISDGRAQMD
INGGACPKILQRCRRDSDCPGACICRGNGYCGSGSDAIDL
ISNGRAQIYINGGACPKILQKCRRDSDCPGACVCQGNGYC
GSGSDALDLISDGGAQIDINGGACPKILQKCRRDSDCPGA
CVCQGNGYCGSGSDALDLMSDGRAQIDINGGACPRILQKC
RRNSDCPSACVCQGNGYCGSGSDALDLMYDGRAQIDINGG
ACPRILKKCRRDSDCPGACVCRGNGYCGSGSDALDLMSDG
RAQIDINGGACPRILKKCRRDSDCPSACICQGNGYCGSGS
DALDLMSDGGAQTGEDINGGGVYDEKQRVCPRILKKCRRD
SDCPGECICQGNGYCG
Organism Momordica dioica

References
Du J, Chan LY, Poth AG, Craik DJ (2019) Discovery and Characterization of Cyclic and Acyclic Trypsin Inhibitors from Momordica dioica. J Nat Prod. 82:293-300

Cross-references
Proteins Encoded TIPTOP1
Links GenBank MH547558