Hyep B (partial)(32) Nucleic Acid Card

General Information
Name Hyep B (partial)
Sequence TGTGGGGAGACGTGCATTTATATTCCATGTTTCACTGAAG
CTGTTGGATGTAAATGCAAGGACAAAGTTTGCTACAAGAA
CTCTCTGGATAACTAA
Notes
Sequence translation CGETCIYIPCFTEAVGCKCKDKVCYKNSLDN
Organism Hybanthus epacroides

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Proteins Encoded Hyep A (partial)
Links