Hyfl M (partial)(25) Nucleic Acid Card

General Information
Name Hyfl M (partial)
Sequence GCTGCTTTTGCTCTTCCTGCCCTTGCAAGTTTTGAGAAAG
ATGTAATCACTCCCAGAGGCATTGAACTTATGCTAAAGAA
AACCAACTTCCCTCTCTCAAACATCATGTTAGAAGAGGAT
ACCATGAGCGCTCTTGTTAAGACTAAGACTCTCATCTCTG
ACACAGTATTCGATGCACTCCTCAAAAACTCCCACACTAA
TGGAGGCAATATTCCCTGTGGCGAATCTTGCATCTTCTTT
CCTTGCTTCAATCCTGGTTGTTCTTGCAAAGACAATCTTT
GCTATTATAACTCTCTTGTTGGAAATTAA
Notes
Sequence translation AAFALPALASFEKDVITPRGIELMLKKTNFPLSNIMLEED
TMSALVKTKTLISDTVFDALLKNSHTNGGNIPCGESCIFF
PCFNPGCSCKDNLCYYNSLVGN
Organism Hybanthus floribundus W

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Proteins Encoded Hyfl M
Hyfl M precursor (partial)
Links