tricyclon A precursor (gene, partial)(236) Nucleic Acid Card

General Information
Name tricyclon A precursor (gene, partial)
Sequence GGCCGCTTTCGCTCTTCCTGCAGCTTTTGCGTCTTTGGAG
ACGAAAGATGTCATCACTCGTGCAGCGTACGAGAAACTAG
TTGAAAGTGGAGCCATTCAGGGCATCACTATGACCAAAAC
CATCATATCAAACCCAATCCTTGAAGAAGCACTGGTGGCT
CACTTTAACCACAAACTTGGTGGCGGTACCATTTTCGATT
GTGGGGAATCGTGCTTTCTTGGTACATGCTACACTAAAGG
TTGTTCTTGCGGTGAATGGAAGTTGTGCTACGGTACAAAT
TCTCTGCCAGAGAGCAACAACGAAAAGGCAATGGTTGCGT
CTTTAGAAACGAAAGATGTCATCACTCGTGCAGCGTACGA
GAAACTCGTCAACAGTGGAGCCATTCAGGGTATTACCATG
ACCAAAACCATCATATCAAACCCAATTCTTGAAGAAGCAC
TGGTGGCTCACTTTAACCGCAAGCTTGGTGGCGGTACCAT
TTTCGATTGTGGCGAATCATGCTTTCTTGGTACATGCTAC
ACTAAAGGTTGTTCTTGCGGCGAGTGGAAGTTGTGCTACG
GTACAAATTCTCTGCCAGAGAGCAACAACGAAAAGGCAAT
GGTTGCATCTTTGGAGACGAAAGATGTCATCACTCGTGCA
GCGTACGAGAACCTCGTCAACAGTGGAGCCATTCAGGGTA
TTACCATGACCAAAACCATCATATCCAACCCAATCCTCGA
AGAAGCACTGGTTTCACACTTTAATCGCAAACTTGGTGGT
GGTACCATTTTCGACTGCGGTGAATCATGCTTTCTTGGTA
CATGCTACACTAAAGGCTGTTCTTGCGGTGAATGGAAGTT
GTGCTACGGTACAAATTCTCTCGCTAT
Notes
Sequence translation AAFALPAAFASLETKDVITRAAYEKLVESGAIQGITMTKT
IISNPILEEALVAHFNHKLGGGTIFDCGESCFLGTCYTKG
CSCGEWKLCYGTNSLPESNNEKAMVASLETKDVITRAAYE
KLVNSGAIQGITMTKTIISNPILEEALVAHFNRKLGGGTI
FDCGESCFLGTCYTKGCSCGEWKLCYGTNSLPESNNEKAM
VASLETKDVITRAAYENLVNSGAIQGITMTKTIISNPILE
EALVSHFNRKLGGGTIFDCGESCFLGTCYTKGCSCGEWKL
CYGTNSLA
Organism Viola tricolor

References
Gruber CW, Elliott AG, Ireland DC, Delprete PG, Dessein S, Göransson U, Trabi M, Wang CK, Kinghorn AB, Robbrecht E, Craik DJ (2008) Distribution and evolution of circular miniproteins in flowering plants. Plant Cell 20:2471-2483

Cross-references
Proteins Encoded Tricyclon A precursor (partial)
Links