kalata B2 precursor gene(235) Nucleic Acid Card

General Information
Name kalata B2 precursor gene
Sequence ATGGCTAAGTTCACCAACTGTCTCGTCCTGAGCTTGCTTC
TAGCAGCATGTAAGTAATATATCATCACATGCATCTCTCT
ATAACTAATTTCACTACAAAGTAATTTTACTTTTTTTAGT
TTTTCAATGTTATCTTGCAGTTGTTGGGGCTTTCGGAGCT
GAGCTTTCTGAAGCCGACAAGGCCACCTTGGTCCGTGATA
TCACTGAGAATATCCAAAAAGAGATACTGGGCGAAGTGAA
GACTTCTGAAACCGTCCTTACGATGTTCCTGAAAGAGATG
CAGCTCAAAGGTCTTCCAGTTTGCGGCGAGACTTGCTTTG
GGGGAACTTGCAACACTCCAGGCTGCTCTTGCACCTGGCC
TATCTGCACACGCGATAGCCTTCCTATGAGGGCTGGAGGA
AAAACATCTGAAACCACCCTTCATATGTTCCAGAAAGAGA
TGCAGCTCAAAGGTCTTCCAGTTTGCGGAGAGACTTGCTT
TGGGGGAACTTGCAACACTCCAGGCTGCTCTTGCACCTGG
CCTATATGCACACGCGATAGCCTTCCTATGAGGGCTGGAG
GAAAAACATCTGAAACCACCCTTCATATGTTCCTGAAAGA
GATGCAGCTCAAAGGTCTTCCAGTTTGCGGCGAGACTTGC
TTTGGGGGAACTTGCAACACTCCAGGCTGCTCGTGCACCT
GGCCTATATGCACACGTGATAGCCTTCCTCTTGTGGCTGC
ATAA
Notes
Sequence translation MAKFTNCLVLSLLLAAFVGAFGAELSEADKATLVRDITEN
IQKEILGEVKTSETVLTMFLKEMQLKGLPVCGETCFGGTC
NTPGCSCTWPICTRDSLPMRAGGKTSETTLHMFQKEMQLK
GLPVCGETCFGGTCNTPGCSCTWPICTRDSLPMRAGGKTS
ETTLHMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPIC
TRDSLPLVAA
Organism Oldenlandia affinis

References
Gruber CW, Elliott AG, Ireland DC, Delprete PG, Dessein S, Göransson U, Trabi M, Wang CK, Kinghorn AB, Robbrecht E, Craik DJ (2008) Distribution and evolution of circular miniproteins in flowering plants. Plant Cell 20:2471-2483

Cross-references
Proteins Encoded Kalata B2 precursor
Links