vocC precursor (partial)(233) Nucleic Acid Card

General Information
Name vocC precursor (partial)
Sequence CTCTCCTTGCTGAGGCACTCACCGCGTTCGCCAAGAAAGG
TCTTGGTGGTCTTCCCGTCTGCGGTGAGACTTGCGTCGGC
GGAACATGCAACACCCCTGGGTGCTCCTGCAGCTGGCCTG
TTTGCACCAGAAATGCTCTTGAGACCCAGAAACCCAACCA
TTTGCTCGAAGAGGCACTCGTTGCATTTGCCAAGAAAGGT
AACCTCGGAGGTCTTCCCGTATGCGGCGAAACTTGCGTTG
GTGGAACCTGTAACACCCCTGGGTGCTCTTGCAGCTGGCC
TGTCTGCATCAGAAACTCTCTTGCCATGTAAGACCGAGAT
CTAGGCATATGACTGGACCATATTGTTCCATTTGTTGTTT
CTTGTTCTTGTTCTTGTTCTTGCCTTTATGTTATTGGAGA
GGAGGCTATACATGCTCGTGACGTATGGATTTAC
Notes
Sequence translation LLAEALTAFAKKGLGGLPVCGETCVGGTCNTPGCSCSWPV
CTRNALETQKPNHLLEEALV AFAKKGNLGGLPVCGETC
VGGTCNTPGCSCSWPVCIRNSLAM
Organism Viola odorata

References
Zarrabi,M., Dalirfardouei,R., Sepehrizade,Z. and Kermanshahi,R.K. (2013) Comparison of the antimicrobial effects of semipurified cyclotides from Iranian Viola odorata against some of plant and human pathogenic bacteria. J. Appl. Microbiol. 115:367-375

Cross-references
Proteins Encoded vocC precursor (partial)
Links