kalata B1 gene [Oak1] (232) Nucleic Acid Card

General Information
Name kalata B1 gene [Oak1]
Sequence ATGGCTAAGTTCACCGTCTGTCTCCTCCTGTGCTTGCTTC
TTGCAGCATGTAAGTAATACTTTATCACATGCATCTCTCT
CTCTAATTAATTTAAGTAGGAAGTAATTATGTTATTATTT
TTTATAATGTTATTTTGCAGTTGTTGGGGCGTTTGGATCT
GAGCTTTCTGACTCCCACAAGACCACCTTGGTCAATGAAA
TCGCTGAGAAGATGCTACAAAGAAAGATATTGGATGGAGT
GGAAGCTACTTTGGTCACTGATGTCGCCGAGAAGATGTTC
CTAAGAAAGATGAAGGCTGAAGCGAAAACTTCTGAAACCG
CCGATCAGGTGTTCCTGAAACAGTTGCAGCTCAAAGGACT
TCCAGTATGCGGTGAGACTTGTGTTGGGGGAACTTGCAAC
ACTCCAGGCTGCACTTGCTCCTGGCCTGTTTGCACACGCA
ATGGCCTTCCTAGTTT
Notes
Sequence translation MAKFTVCLLLCLLLAAFVGAFGSELSDSHKTTLVNEIAEK
MLQRKILDGVEATLVTDVAE KMFLRKMKAEAKTSETAD
QVFLKQLQLKGLPVCGETCVGGTCNTPGCTCSWPVCTRNG
LP S
Organism Oldenlandia affinis

References
Gruber CW, Elliott AG, Ireland DC, Delprete PG, Dessein S, Göransson U, Trabi M, Wang CK, Kinghorn AB, Robbrecht E, Craik DJ (2008) Distribution and evolution of circular miniproteins in flowering plants. Plant Cell 20:2471-2483

Cross-references
Proteins Encoded kalata B1 precursor
Links