PETUNITIDE2 mRNA(230) Nucleic Acid Card

General Information
Name PETUNITIDE2 mRNA
Sequence AGACTCTCTCTACATATCTCTCTATTGGCAAAGATAATAC
TTTCAATAATGGCCGGAGTTAACTCACTTAGATCTGCTTT
GTACTTAATTATTCTTATACTCTTCGTTCAATTGACTAAT
TTTCAAGAATCACGCGTAATGGCTGTGGAACTGTCACGTG
TGTTTCTGCCACTATCAGGAGTTCCTTGTGGCGAGTCTTG
TGTTTGGATGTATTGCATAAGTGCAGCTATGGGTTGTTCA
TGCCGTAATAAAGTTTGCTATAGAAATGAAATTATACAAG
AAAAATAATTGGATCTTCCTGCGTTCAATATAATACCATG
TAATGCCGAGTTAGGAGAGGGGCATATATATGGTTGTGGT
TAGACGTATTGAACGGTTTATTCAGTAATAATTATATCAT
ATTGGTATGTGTGTATTTTTATCTATTGAATTTGTGTCAA
AGTCTAGCACTATGTGTAGCTGGCAAGATTGTTGTATTAT
AATTTTTGCATTTCTGTACTCAAGTTACTCTGCCCAGACC
CCACCTTGGTGGAAAATCACTGGGTATGTTGTTGTTGTAC
TCAAGTCGCTAATAAAATGGCTCTCCTATTGTGTTCTAGA
GAATATAAGTTATTTGCTTAAAAAAAAAAAAAA
Notes
Sequence translation MAGVNSLRSALYLIILILFVQLTNFQESRVMAVELSRVFL
PLSG VPCGESCVWMYCISAAMGCSCRNKVCYRNEIIQE
K
Organism Petunia x hybrida

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Proteins Encoded Phyb B precursor
Links