Hyfl O (partial)(23) Nucleic Acid Card

General Information
Name Hyfl O (partial)
Sequence TGTGGGGAGACGTGCGTCATTTTCCCATGCATCTCCGCTG
CTTTTGGGTGCTCTTGCAAGGACACAGTTTGCTACAAAAA
CTCTCTTGTCAACTGA
Notes
Sequence translation CGETCVIFPCISAAFGCSCKDTVCYKNSLVN
Organism Hybanthus floribundus W

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Proteins Encoded Hyfl O (partial)
Hyfl O precursor (partial)
Links