Phyb K cDNA(226) Nucleic Acid Card

General Information
Name Phyb K cDNA
Sequence TCTCTCTATTGAAAAGATAATACTCTCAATAATGGCTAGA
GTCAACTCACTCAAATGTGCTTTGTGCTTTATTGTTCTTA
TACTCTTTGTTCAATTGAATTGTATTCCCGAAACACGCGT
AATGGCTGTGGAACTGTCACGTGTGTTTCTGCAAACATCA
TCAACTGATTGTGGCGAGCCTTGTGTTTATATCCCTTGCA
CTATAACTGCACTCTTAGGTTGTTCCTGCCTAAATAAGGT
TTGTGTTAGACCATAAAAATAATTGAATATTCCTACGTTT
AATATAATACCATGTAATGCCGACTTAGGAGAGAGGCATA
TATATGGTTGTGGACTTGTGGTTAGACGTGATGAACGGAA
TAATCGAATAATAATTATATCACTTTGTAATGTGTCTATT
TTGATCTATTGAATTTGTGTCAAAATCCAGCACCATGTGC
AGCTGGCAAGATTGTTGTATTACGTTTTTTGCATTTTTGT
ACTCAAGTTACTTTTTCCAAACCTCACCTTGNTGGAAAAT
CACTGAGTATGCTATTATTGTTGTACTCAAGTTACTAATA
AAACGACTCTCCTATTGTGTTTTTAGTCATATTAAAAAAA
AGAAAAAAAAA
Notes
Sequence translation MARVNSLKCALCFIVLILFVQLNCIPETRVMAVELSRVFL
QTSSTDCGEP CVYIPCTITALLGCSCLNKVCVRP
Organism Petunia x hybrida

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046
Breuillin,F., Schramm,J., Hajirezaei,M., Ahkami,A., Favre,P., Druege,U., Hause,B., Bucher,M., Kretzschmar,T., Bossolini,E., Kuhlemeier,C., Martinoia,E., Franken,P., Scholz,U. and Reinhardt,D. (2010) Phosphate systemically inhibits development of arbuscular mycorrhiza in Petunia hybrida and represses genes involved in mycorrhizal functioning. Plant J. 64:1002-1017

Cross-references
Proteins Encoded Phyb K precursor
Links