Phyb H mRNA(216) Nucleic Acid Card

General Information
Name Phyb H mRNA
Sequence TATGTAGTTGTTGTACACTCTTGGTAACTAAATAACTTTA
TCCTATTTATTTCTTTCTTATTTTTTATCTCTTAATTATT
ACATAAGTTATTTTTATTTTTGCATAACAGAATGTACATA
CTCAACCAGATTTTTCTATGTCTTGTTTAGTTCAATTGAC
TTGCTTTTCTGACGCACGCGTAATGGATGTGGATTTGTCA
AGTGTGTTTCTGCCACTATCAGGACTTCCTTGTGGCGAGT
CTTGTATTTGGATCGAGTGTATAAGTGGAGCTATAGGTTG
TTCATGTCGTAATAAGGTTTGCTATAGAAATGAAATTATA
CCAGAAAATAATTGAATCTTCCTGCGTTCAATATAATACC
ATGTAATGCCGAGTTAGGAGAGGGGCATATATATGGTTGT
GGTTAAAACGTAATGAATTGGGGTAATTCAATAATAATAA
TTATATCATGTTGGAATGCGTGTATTTCTATCTATTGAAT
TTGTGTCAAGTTTAGCACCTATGTTGTTAGTTTGGCAAGA
TTGTTGTATTAAATGATTTTGCATTTCTGTACTCAAGTTA
CTCTGCCCAGACCCCCACCTTGATGGAAAATTACTGGGTA
TGTAGTTGTTGTACTCAAGTTACTAATAAATGGCTCTCCT
ATTGTGTT
Notes
Sequence translation MSCLVQLTCFSDARVMDVDLSSVFLPLSGLPCGESCIWIE
CISGAIGCSCRNKVCYRNEIIPENN
Organism Petunia x hybrida

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046
Zenoni,S., D Agostino,N., Tornielli,G.B., Quattrocchio,F., Chiusano,M.L., Koes,R., Zethof,J., Guzzo,F., Delledonne,M., Frusciante,L., Gerats,T. and Pezzotti,M. (2011) Revealing impaired pathways in the an11 mutant by high-throughput characterization of Petunia axillaris and Petunia inflata transcriptomes. Plant J. 68:11-27

Cross-references
Proteins Encoded Phyb H precursor
Links