Hyfl D (partial)(21) Nucleic Acid Card

General Information
Name Hyfl D (partial)
Sequence GCTGCTTTCGCTCTTCCTGCCATTGCAACCTTGGAGAAAG
ATGTCATCACTCCTAAAGCCATCGAACTCATTCTCAAAAA
GACAAACACTCCTCTTTCTAACATCATGCTAGAAGAGGAT
GCCCTCGTCAATGCTTTTGTTAAGTCCAAAACTATGATTT
CTAACACAGTTTTTGATGAAGCTCTTCTCAAGCACTCCAA
CCATGGCCTTGGGGGCAGTGTTCCCTGCGGTGAAAGTTGC
GTTTATATTCCATGTTTCACTGGCATTGCTGGATGTTCTT
GCAAGAGCAAAGTTTGCTACTACAACTCTCTGGATAACTA
A
Notes
Sequence translation AAFALPAIATLEKDVITPKAIELILKKTNTPLSNIMLEED
ALVNAFVKSKTMISNTVFDEALLKHSNHGLGGSVPCGESC
VYIPCFTGIAGCSCKSKVCYYNSLDN
Organism Hybanthus floribundus E

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Proteins Encoded Hyfl D
Hyfl D precursor protein (partial)
Links