Phyb F mRNA (partial)(208) Nucleic Acid Card

General Information
Name Phyb F mRNA (partial)
Sequence TACTCAACCTGATTTTTCTATATCTTGTTCAGTTCAATTG
ACTTGCTTTTCCGACGCACGCGTAATGGATGTAGATTTGT
CACGTGTGTTTCTGCCACTATCAGGAATTCCTTGTGGCGG
GTCTTGTGTTTGGATCCCTTGCATAAGTGGAGTTCAAGGT
TGTTCATGCTCTAATAAGATTTGCTATCGCAATGGAATTA
TACCAGAAAACTAATTGGATCTTCATGCGTTCAATATAAT
ACCATGTAATGCCGAGTTAGGAGAGGGACATATATATGGT
TGTGGTTAGACGTAATGAACGGAGTTATTCAATAATAATT
ATATCATGTTGGTATGTGTGTATTTCTATCTATTGAATTT
GTGTCAAAGTCTAGCACTATGCGTAGCTGGCAAGATTGTT
GTATTATGATTTTTGCATTCCT
Notes A partial sequence of this one was also submitted by Breuillin et al. with the GI 227598371.
Sequence translation TQPDFSISCSVQLTCFSDARVMDVDLSRVFLPLSGIPCGG
SCVWIPCISGVQGCSCSNKI CYRNGIIPEN
Organism Petunia x hybrida

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046
Breuillin,F., Schramm,J., Hajirezaei,M., Ahkami,A., Favre,P., Druege,U., Hause,B., Bucher,M., Kretzschmar,T., Bossolini,E., Kuhlemeier,C., Martinoia,E., Franken,P., Scholz,U. and Reinhardt,D. (2010) Phosphate systemically inhibits development of arbuscular mycorrhiza in Petunia hybrida and represses genes involved in mycorrhizal functioning. Plant J. 64:1002-1017

Cross-references
Proteins Encoded Phyb F precursor (partial)
Links