Phyb D mRNA (partial)(204) Nucleic Acid Card

General Information
Name Phyb D mRNA (partial)
Sequence CACTCAGATCTGCTTTGTACTTAATTGTTCTTATACTCTT
CGTTCAATTGACTTGCTTTTCCGACGCACGCGTAATGGAT
GTGGATTTGTCACGTGTATTTCTGCCACTATCAGGAATTC
CTTGTGGCGAGTCTTGTATGTGGATCCCTTGCATAAGTGC
AGCTATAGGTTGTTCATGCACTAATCACGTTTGCTATAAG
AATGGAATTATACCAGACAAATAATTGGATCTTCATGCGT
TCAATATAATACCATGTAATGCCGAGTTAGGAGAGGGGCA
TATATATGGTTGTGGTTAAACGTAATGAACGGAGTAATTC
AATAATAATTATATCATATTCGTATGTGTGTATTTCTATC
TATTGAATTTGTGTCAAAGTCTAGCACTATGTGTAGCTGG
CAAGATTATTGTATTATGATTTTTGCATTCCTGTATTCAA
GTTACTCTGCCCA
Notes
Sequence translation LRSALYLIVLILFVQLTCFSDARVMDVDLSRVFLPLSGIP
CGESCMWIPCISAAIGCSCT NHVCYKNGIIPDK
Organism Petunia integrifolia

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046
Zenoni,S., D Agostino,N., Tornielli,G.B., Quattrocchio,F., Chiusano,M.L., Koes,R., Zethof,J., Guzzo,F., Delledonne,M., Frusciante,L., Gerats,T. and Pezzotti,M. (2011) Revealing impaired pathways in the an11 mutant by high-throughput characterization of Petunia axillaris and Petunia inflata transcriptomes. Plant J. 68:11-27

Cross-references
Proteins Encoded Phyb D precursor
Links