Phyb A mRNA (partial)(202) Nucleic Acid Card

General Information
Name Phyb A mRNA (partial)
Sequence CTTAATTGTTCTTATACTCTTCGTTCAATTGACTTGCTTT
TCCGACGCACGCGTAATGGATGTGGATTTGTCACGTGCGT
TTCTGCCACTAACAGGAATTGGTTGTGGCGAGTCTTGTGT
TTGGATCCCTTGCGTAAGTGCAGCTATAGGTTGTTCATGC
TCTAATAAGATTTGTTATCGCAATGGAATTATACCAAAAA
AATAATTGGATCTTCATGCGTTCAATATACTACTATGTAA
TGTCGAGCTAGGAGAGGGGCATATATATGGTTGTGGTTAG
ACGTAATGAACGGAGTAATTCAATAATAATTATATCATGT
TGGTATGTGTGTATTTCTATTTATTGAATTTGTGTTAAAG
TCTAGCACTATGTGTAGCTGGCAAGATTGTTATATTATGA
TTTTTGCATTCTTGTATTCAAGTTACTCTGCCCAGACTCC
ACCTTGGTGGGAAATCACTGGGTATGTAGTTGTTG
Notes A partial sequence (only four nt less) was in another nucleotide entry from Breuillin et al. (GI: 227615309).
Sequence translation LIVLILFVQLTCFSDARVMDVDLSRAFLPLTGIGCGESCV
WIPCVSAAIGCSCSNKICYR NGIIPKK
Organism Petunia x hybrida

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046
Breuillin,F., Schramm,J., Hajirezaei,M., Ahkami,A., Favre,P., Druege,U., Hause,B., Bucher,M., Kretzschmar,T., Bossolini,E., Kuhlemeier,C., Martinoia,E., Franken,P., Scholz,U. and Reinhardt,D. (2010) Phosphate systemically inhibits development of arbuscular mycorrhiza in Petunia hybrida and represses genes involved in mycorrhizal functioning. Plant J. 64:1002-1017

Cross-references
Proteins Encoded Phyb A precursor (partial)
Links