kalata B7 precursor [OaK3](2) Nucleic Acid Card

General Information
Name kalata B7 precursor [OaK3]
Sequence GGCAGGAGCTTCTTATAATTTTACTGCTTTTCTTATTTCT
AGAGAAAGGAGAAATTCGATCTTCCATGGCTAAGTTCACC
AACTGTCTCGCCCTGTGCTTGCTTCTTGCAGCAGTTGTTG
GGGCTTTCGGAGTTGAGCTTTCTGAAGCCGACAAGAGCGC
CGTGGTCAATGAAATCGCTGAGAAGATGGCCCTACAGGAG
ATGCTGGACGGAGTCGACAAGCTGTTCCTGAGGAAGATGA
AAAGCTCTGAAACCACCCTCACCATGTTCCTGAAAGAGAT
GCAGCTCAAAGGTCTTCCAGTCTGCGGTGAGACTTGCACT
TTGGGAACTTGCTATACTCAAGGCTGCACTTGCTCCTGGC
CTATCTGCAAGCGCAATGGCCTTCCTGATGTGGCCGCATA
ATTTGCTCGATCAAAAACTGCAGAAATGAATAAGAAGGGA
TACCAAATAATGCTATGAATATTGTTGGTCCCTGTGTCTG
TTGATTTGGTTGGCTAGCTCCGAACCATATGTTCTGCTTG
TGTTTTTCGTTTTTGTTTTCTCTTTTGGGCACTCTTCATA
TGACATAAAGAGATCTTGGATCTGATATTGGTCACATGTT
AATACCCAATTTCAAAAAATCGTTGTTATCGTTGTCATTA
AAAAAAAAAAAAAAAAA
Notes
Sequence translation MAKFTNCLALCLLLAAVVGAFGVELSEADKSAVVNEIAEK
MALQEMLDGVDKLFLRKMKSSETTLTMFLKEMQLKGLPVC
GETCTLGTCYTQGCTCSWPICKRNGLPDVAA
Organism Oldenlandia affinis

References
Jennings C, West J, Waine C, Craik D, Anderson M (2001) Biosynthesis and insecticidal properties of plant cyclotides: the cyclic knotted proteins from Oldenlandia affinis. Proc Natl Acad Sci U S A 98:10614-9

Cross-references
Proteins Encoded kalata B7
kalata B7 precursor
Oantr protein
Links