chassatide C14 mRNA, complete cds(195) Nucleic Acid Card

General Information
Name chassatide C14 mRNA, complete cds
Sequence ATGGCCAAGTTTGCTACTCAGCTCTTGCTCTTTGTGCTCA
TTGCATCACTTGTGATGTTGGAAGTTCACGCTTCCAATAC
TTTCCAAGTCCCCGATTTGGGAAAAAGGCTGCTGATGAAT
CGTGACCCGAACGGCATACCATGTGCTGAATCGTGCGTTT
ATATCCCGTGCACTATCACTGCTCTTTTTGGCTGCAGTTG
CAAGGATAAAGTCTGCTATAATAATGAATTATAA
Notes
Sequence translation MAKFATQLLLFVLIASLVMLEVHASNTFQVPDLGKRLLMN
RDPNGIPCAESCVYIPCTITALFGCSCKDKVCYNNEL
Organism Chassalia chartacea

References
Nguyen,G.K., Lian,Y., Pang,E.W., Nguyen,P.Q., Tran,T.D. and Tam,J.P. (2013) Discovery of linear cyclotides in monocot plant Panicum laxum of Poaceae family provides new insights into evolution and distribution of cyclotides in plants. J. Biol. Chem. 288:3370-3380

Cross-references
Proteins Encoded chassatide C14 precursor
Links