chassatide C13 gene, complete cds(190) Nucleic Acid Card

General Information
Name chassatide C13 gene, complete cds
Sequence ATGGCCAAGTTTGCTACTCAGCTCTTGCTCTTTGTGCTCA
TTGCATCACTTGTGATGTTGGAAGTTCACGCTTCCAATAC
TTTCCAAGTCCCCGATTTGGGAAAAAGGCTGCTGATGAAT
CGTGACCCTAACGGCTTCCCATGTGCTGAATCATGCGTTT
ATATCCCGTGCACTGTCACTGCTCTTCTGGGCTGCAGTTG
CAGAAATCGAGTCTGCTATAGGAATGAATTATAA
Notes
Sequence translation MAKFATQLLLFVLIASLVMLEVHASNTFQVPDLGKRLLMN
RDPNGFPCAESCVYIPCTVTALLGCSCRNRVCYRNEL
Organism Chassalia chartacea

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Proteins Encoded chassatide C13 precursor
Links