Hyfl F (partial)(19) Nucleic Acid Card

General Information
Name Hyfl F (partial)
Sequence AGTATATCATGCGGTGAAACTTGTACCACTTTTAATTGCT
GGATTCCTAATTGTAAATGCAACCACCACGACAAAGTTTG
CTATTGGAACTCTCTTGATGAAAATTAA
Notes
Sequence translation SISCGETCTTFNCWIPNCKCNHHDKVCYWNSLDEN*
Organism Hybanthus floribundus E

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Proteins Encoded Hyfl F
Hyfl F precursor protein (partial)
Links