violacin A precursor(18) Nucleic Acid Card

General Information
Name violacin A precursor
Sequence GTCTCACACACACAACAAAGCAGTAAAAGAAACACAAAAA
ATAAACGAAAGAAAGAAAGAAGCATGGATGCCCAAAAGAT
GAAGATGGTGATCGGTCTTGTGCTGGTCGCCACAACCGCT
TTTGCTCTGATGATCCCTGCAGCTTCCGCAGTGGACGATT
TCATCACTCGTCGAGCATACGACAATCTTGTCAAGAGCGG
TGCCATCAAAGACATTCCAGTCATGGCCAAAACCATCATC
TCAAACCCAGTCCTGGAAGAAGGAATGCTTACTTATTACA
CTAACAAAAAACTCGGCGACAGCGCCATTTCATGTGGGGA
AACTTGCTTCAAGTTTAAATGCTACACTCCTAGGTGTAGC
TGCAGCTATCCCGTATGCAAATAAAATTCTCTAGACAACA
GTTCCACGGCTGATGCGTTTGCCAGGAAAGCTGTTTATGG
TAATTAATTAATTAATTATGCTCGACAAATGCATCTACAT
GTTGTCTAGATTGATTAATTAATAATGTTGCAAAAAAGTT
CTGTCGTACCTATAATTAATTATGCGTGTTTTCTCAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MDAQKMKMVIGLVLVATTAFALMIPAASAVDDFITRRAYD
NLVKSGAIKDIPVMAKTIISNPVLEEGMLTYYTNKKLGDS
AISCGETCFKFKCYTPRCSCSYPVCK*NSLDN
Organism Viola odorata

References
Ireland DC, Colgrave ML, Nguyencong P, Daly NL, Craik DJ (2006) Discovery and characterization of a linear cyclotide from Viola odorata: implications for the processing of circular proteins. J Mol Biol 357:1522-35

Cross-references
Proteins Encoded violacin A precursor
violacin A
Links